PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010551818.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 295aa    MW: 33755.2 Da    PI: 9.6542
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010551818.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.26.1e-1699144148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rgr ++eE +l ++++k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_010551818.1  99 RGRLSPEEVDLVIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 144
                      8999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.1356993IPR017877Myb-like domain
SuperFamilySSF466892.59E-1979152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-879106IPR009057Homeodomain-like
PROSITE profilePS5129426.11894148IPR017930Myb domain
SMARTSM007174.1E-1598146IPR001005SANT/Myb domain
PfamPF002493.0E-1499144IPR001005SANT/Myb domain
CDDcd001675.53E-11103144No hitNo description
Gene3DG3DSA:1.10.10.603.5E-19107144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSCSLNKPAH GSRTSSEFFG LSANQFNKET SINAYTNTHT HTYIIKRSYY GLFLTKSKET  60
NRLTDRDIVF SRLCFVGLNR CRKSCRLRWL NYLKPSIKRG RLSPEEVDLV IRLHKLLGNR  120
WSLIAGRLPG RTANDVKNYW NTHLSKKQDQ PSHSKTAPAC KKKINVGFPT EPVQKIDVIK  180
PRPRSFSDST QRRLLNPPPE IPFRGSKNKD SDNNDGNNDD IFHGKKTITG CICKDEYEIT  240
STVVKEGREV MWWENLLEEG EGTAAEEDEK IAAESSWMNN SPATFDVDLW NLLNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-168014940109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010551818.10.0PREDICTED: transcription factor MYB90-like isoform X1
SwissprotQ9FNV98e-53MY113_ARATH; Transcription factor MYB113
TrEMBLE5D8F53e-55E5D8F5_BRAOB; MYB2
STRINGBra004162.1-P3e-53(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-53myb domain protein 113